SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ceva_ (1cev A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2115321Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 2115322Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 2115323Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 protein domains)
    Pfam PF00491
  6. 2115344Protein Arginase [52770] (5 species)
  7. 2115345Species Bacillus caldovelox [TaxId:33931] [52772] (5 PDB entries)
  8. 2115358Domain d1ceva_: 1cev A: [32588]
    complexed with mn

Details for d1ceva_

PDB Entry: 1cev (more details), 2.4 Å

PDB Description: arginase from bacillus caldovelox, native structure at ph 5.6
PDB Compounds: (A:) protein (arginase)

SCOPe Domain Sequences for d1ceva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ceva_ c.42.1.1 (A:) Arginase {Bacillus caldovelox [TaxId: 33931]}
mkpisiigvpmdlgqtrrgvdmgpsamryagvierlerlhydiedlgdipigkaerlheq
gdsrlrnlkavaeaneklaaavdqvvqrgrfplvlggdhsiaigtlagvakhyerlgviw
ydahgdvntaetspsgnihgmplaaslgfghpaltqiggyspkikpehvvligvrsldeg
ekkfirekgikiytmhevdrlgmtrvmeetiaylkertdgvhlsldldgldpsdapgvgt
pviggltyreshlamemlaeaqiitsaefvevnpildernktasvavalmgslfgeklm

SCOPe Domain Coordinates for d1ceva_:

Click to download the PDB-style file with coordinates for d1ceva_.
(The format of our PDB-style files is described here.)

Timeline for d1ceva_: