SCOPe 2.08: Domain d4rlac_: 4rla C:

Lineage for d4rlac_ (4rla C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456

4. Superfamily c.42.1: Arginase/deacetylase [52768] (3 families)

5. Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins)
   Pfam PF00491

6. Protein Arginase [52770] (5 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52771] (34 PDB entries)
   Uniprot P07824

8. Domain d4rlac_: 4rla C: [32569]
   complexed with mn

Details for d4rlac_

PDB Entry: 4rla, 2.94 Å

PDB Description: altering the binuclear manganese cluster of arginase diminishes thermostability and catalytic function

PDB Compounds: (C:) arginase

SCOPe Domain Sequences for d4rlac_:

Sequence; same for both SEQRES and ATOM records:

>d4rlac_ c.42.1.1 (C:) Arginase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdnsmaigsisgharvhpdlcviwvda
htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl

Timeline for d4rlac_:

• d4rlac_ first appeared (with stable ids) in SCOP 1.55
  
• d4rlac_ appears in SCOPe 2.07