SCOPe 2.07: Domain d5l5ua_: 5l5u A:

Lineage for d5l5ua_ (5l5u A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d5l5ua_: 5l5u A: [325675]
   Other proteins in same PDB: d5l5ub_, d5l5uc_, d5l5ud_, d5l5ue_, d5l5uf_, d5l5ug_, d5l5uh_, d5l5uk_, d5l5ul_, d5l5um_, d5l5up_, d5l5uq_, d5l5ur_, d5l5us_, d5l5ut_, d5l5uu_, d5l5uv_, d5l5uy_, d5l5uz_
   automated match to d1jd2v_
   complexed with 04c, cl, mg

Details for d5l5ua_

PDB Entry: 5l5u, 2.6 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138; v31m) and human beta6 (97-111; 118-133) in complex with epoxyketone inhibitor 17

PDB Compounds: (A:) Proteasome subunit alpha type-2

SCOPe Domain Sequences for d5l5ua_:

Sequence; same for both SEQRES and ATOM records:

>d5l5ua_ d.153.1.4 (A:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mtdrysfslttfspsgklgqidyaltavkqgvtslgikatngvviatekksssplamset
lskvslltpdigavysgmgpdyrvlvdksrkvahtsykriygeypptkllvsevakimqe
atqsggvrpfgvslliaghdefngfslyqvdpsgsyfpwkataigkgsvaaktflekrwn
deleledaihialltlkesvegefngdtielaiigdenpdllgytgiptdkgprfrklts
qeindrleal

Timeline for d5l5ua_:

• d5l5ua_ first appeared in SCOPe 2.06
  
• d5l5ua_ appears in the current release, SCOPe 2.08