Lineage for d1rlac_ (1rla C:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) Superfamily c.42.1: Arginase/deacetylase [52768] (2 families) 
Family c.42.1.1: Arginase [52769] (1 protein) Protein Arginase [52770] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [52771] (6 PDB entries) 
Domain d1rlac_: 1rla C: [32563]
Details for d1rlac_
PDB Entry: 1rla (more details), 2.1 Å
PDB Description: three-dimensional structure of rat liver arginase, the binuclear manganese metalloenzyme of the urea cycle
SCOP Domain Sequences for d1rlac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rlac_ c.42.1.1 (C:) Arginase {Rat (Rattus norvegicus)}
kpieiigapfskgqprggvekgpaalrkaglveklketeynvrdhgdlafvdvpndspfq
ivknprsvgkaneqlaavvaetqkngtisvvlggdhsmaigsisgharvhpdlcviwvda
htdintplttssgnlhgqpvafllkelkgkfpdvpgfswvtpcisakdivyiglrdvdpg
ehyiiktlgikyfsmtevdklgigkvmeetfsyllgrkkrpihlsfdvdgldpvftpatg
tpvvgglsyreglyiteeiyktgllsgldimevnptlgktpeevtrtvntavaltlscfg
tkregnhkpetdyl
SCOP Domain Coordinates for d1rlac_:
Click to download the PDB-style file with coordinates for d1rlac_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rlac_:
- d1rlac_ appears in SCOP 1.57
- d1rlac_ appears in the current release, SCOPe 2.08
View in 3D
