Lineage for d1ga1a_ (1ga1 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) Fold c.41: Subtilisin-like [52742] (1 superfamily) Superfamily c.41.1: Subtilisin-like [52743] (2 families) 
Family c.41.1.2: Serine-carboxyl proteinase PSCP [52764] (1 protein) Protein Serine-carboxyl proteinase PSCP [52765] (1 species) Species Pseudomonas sp. [TaxId:306] [52766] (3 PDB entries) 
Domain d1ga1a_: 1ga1 A: [32557]
Details for d1ga1a_
PDB Entry: 1ga1 (more details), 1.4 Å
PDB Description: crystal structure analysis of pscp (pseudomonas serine-carboxyl proteinase) complexed with a fragment of iodotyrostatin (this enzyme renamed "sedolisin" in 2003)
SCOP Domain Sequences for d1ga1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ga1a_ c.41.1.2 (A:) Serine-carboxyl proteinase PSCP {Pseudomonas sp.}
gtakghnptefptiydassaptaanttvgiitiggvsqtlqdlqqftsanglasvntqti
qtgssngdysddqqgqgewdldsqsivgsaggavqqllfymadqsasgntgltqafnqav
sdnvakvinvslgwceadanadgtlqaedrifataaaqgqtfsvssgdegvyecnnrgyp
dgstysvswpasspnviavggttlyttsagaysnetvwnegldsngklwatgggysvyes
kpswqsvvsgtpgrrllpdisfdaaqgtgaliynygqlqqiggtslaspifvglwarlqs
ansnslgfpaasfysaisstpslvhdvksgnngyggygynagtgwdyptgwgsldiakls
ayirsngfgh
SCOP Domain Coordinates for d1ga1a_:
Click to download the PDB-style file with coordinates for d1ga1a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ga1a_:
- d1ga1a_ appears in SCOP 1.57
- d1ga1a_ appears in the current release, SCOPe 2.08
View in 3D