Lineage for d1ga6a_ (1ga6 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2453146Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2453147Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2453483Family c.41.1.2: Serine-carboxyl proteinase, SCP [52764] (2 protein domains)
    elaborated with additional structures
  6. 2453484Protein Serine-carboxyl proteinase, SCP [52765] (3 species)
  7. 2453502Species Pseudomonas sp., sedolisin [TaxId:306] [52766] (9 PDB entries)
  8. 2453505Domain d1ga6a_: 1ga6 A: [32556]
    CASP4
    complexed with act, ca, gol

Details for d1ga6a_

PDB Entry: 1ga6 (more details), 1 Å

PDB Description: crystal structure analysis of pscp (pseudomonas serine-carboxyl proteinase) complexed with a fragment of tyrostatin (this enzyme renamed "sedolisin" in 2003)
PDB Compounds: (A:) serine-carboxyl proteinase

SCOPe Domain Sequences for d1ga6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ga6a_ c.41.1.2 (A:) Serine-carboxyl proteinase, SCP {Pseudomonas sp., sedolisin [TaxId: 306]}
agtakghnptefptiydassaptaanttvgiitiggvsqtlqdlqqftsanglasvntqt
iqtgssngdysddqqgqgewdldsqsivgsaggavqqllfymadqsasgntgltqafnqa
vsdnvakvinvslgwceadanadgtlqaedrifataaaqgqtfsvssgdegvyecnnrgy
pdgstysvswpasspnviavggttlyttsagaysnetvwnegldsngklwatgggysvye
skpswqsvvsgtpgrrllpdisfdaaqgtgaliynygqlqqiggtslaspifvglwarlq
sansnslgfpaasfysaisstpslvhdvksgnngyggygynagtgwdyptgwgsldiakl
sayirsngf

SCOPe Domain Coordinates for d1ga6a_:

Click to download the PDB-style file with coordinates for d1ga6a_.
(The format of our PDB-style files is described here.)

Timeline for d1ga6a_: