Lineage for d1bjre_ (1bjr E:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 990724Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 990725Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 990726Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 990764Protein Proteinase K [52762] (1 species)
  7. 990765Species Fungus (Tritirachium album), strain limber [TaxId:37998] [52763] (18 PDB entries)
    Uniprot P06873
  8. 990782Domain d1bjre_: 1bjr E: [32555]
    complexed with ca

Details for d1bjre_

PDB Entry: 1bjr (more details), 2.44 Å

PDB Description: complex formed between proteolytically generated lactoferrin fragment and proteinase k
PDB Compounds: (E:) Proteinase K

SCOPe Domain Sequences for d1bjre_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjre_ c.41.1.1 (E:) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOPe Domain Coordinates for d1bjre_:

Click to download the PDB-style file with coordinates for d1bjre_.
(The format of our PDB-style files is described here.)

Timeline for d1bjre_: