Lineage for d3prke_ (3prk E:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2114952Family c.41.1.1: Subtilases [52744] (14 protein domains)
  6. 2114990Protein Proteinase K [52762] (1 species)
  7. 2114991Species Fungus (Tritirachium album), strain limber [TaxId:37998] [52763] (39 PDB entries)
    Uniprot P06873
  8. 2115012Domain d3prke_: 3prk E: [32554]
    complexed with ca

Details for d3prke_

PDB Entry: 3prk (more details), 2.2 Å

PDB Description: inhibition of proteinase k by methoxysuccinyl-ala-ala-pro-ala- chloromethyl ketone. an x-ray study at 2.2-angstroms resolution
PDB Compounds: (E:) Proteinase K

SCOPe Domain Sequences for d3prke_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3prke_ c.41.1.1 (E:) Proteinase K {Fungus (Tritirachium album), strain limber [TaxId: 37998]}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa

SCOPe Domain Coordinates for d3prke_:

Click to download the PDB-style file with coordinates for d3prke_.
(The format of our PDB-style files is described here.)

Timeline for d3prke_: