Lineage for d1egqa_ (1egq A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) Fold c.41: Subtilisin-like [52742] (1 superfamily) Superfamily c.41.1: Subtilisin-like [52743] (2 families) 
Family c.41.1.1: Subtilases [52744] (7 proteins) 
Protein Proteinase K [52762] (1 species) Species Fungus (Tritirachium album), strain limber [TaxId:37998] [52763] (8 PDB entries) 
Domain d1egqa_: 1egq A: [32550]
Details for d1egqa_
PDB Entry: 1egq (more details), 1.55 Å
PDB Description: enhancement of enzyme activity through three-phase partitioning: crystal structure of a modified serine proteinase at 1.5 a resolution
SCOP Domain Sequences for d1egqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1egqa_ c.41.1.1 (A:) Proteinase K {Fungus (Tritirachium album), strain limber}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa
SCOP Domain Coordinates for d1egqa_:
Click to download the PDB-style file with coordinates for d1egqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1egqa_:
- d1egqa_ appears in SCOP 1.57
- d1egqa_ appears in the current release, SCOPe 2.08
View in 3D