SCOPe 2.07: Domain d5l5sp_: 5l5s P:

Lineage for d5l5sp_ (5l5s P:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d5l5sp_: 5l5s P: [325489]
   Other proteins in same PDB: d5l5sa_, d5l5sc_, d5l5sd_, d5l5se_, d5l5sg_, d5l5si_, d5l5sj_, d5l5sk_, d5l5sl_, d5l5sn_, d5l5so_, d5l5sq_, d5l5sr_, d5l5ss_, d5l5su_, d5l5sw_, d5l5sx_, d5l5sy_, d5l5sz_
   automated match to d1z7qc1
   complexed with 39v, cl, mg

Details for d5l5sp_

PDB Entry: 5l5s, 2.6 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138; v31m) and human beta6 (97-111; 118-133) in complex with pr-924

PDB Compounds: (P:) Proteasome subunit alpha type-3

SCOPe Domain Sequences for d5l5sp_:

Sequence; same for both SEQRES and ATOM records:

>d5l5sp_ d.153.1.4 (P:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gsrrydsrttifspegrlyqveyalesishagtaigimasdgivlaaerkvtstlleqdt
steklyklndkiavavagltadaeilintarihaqnylktynedipveilvrrlsdikqg
ytqhgglrpfgvsfiyagyddrygyqlytsnpsgnytgwkaisvgantsaaqtllqmdyk
ddmkvddaielalktlskttdssaltydrlefatirkgandgevyqkifkpqeikdilvk
tgit

Timeline for d5l5sp_:

• d5l5sp_ first appeared in SCOPe 2.06
  
• d5l5sp_ appears in the current release, SCOPe 2.08