Lineage for d2prk__ (2prk -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) Fold c.41: Subtilisin-like [52742] (1 superfamily) Superfamily c.41.1: Subtilisin-like [52743] (2 families) 
Family c.41.1.1: Subtilases [52744] (7 proteins) 
Protein Proteinase K [52762] (1 species) Species Fungus (Tritirachium album), strain limber [TaxId:37998] [52763] (8 PDB entries) 
Domain d2prk__: 2prk - [32548]
Details for d2prk__
PDB Entry: 2prk (more details), 1.5 Å
PDB Description: synchrotron x-ray data collection and restrained least-squares refinement of the crystal structure of proteinase k at 1.5 angstroms resolution
SCOP Domain Sequences for d2prk__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2prk__ c.41.1.1 (-) Proteinase K {Fungus (Tritirachium album), strain limber}
aaqtnapwglarisstspgtstyyydesagqgscvyvidtgieashpefegraqmvktyy
yssrdgnghgthcagtvgsrtygvakktqlfgvkvlddngsgqystiiagmdfvasdknn
rncpkgvvaslslgggysssvnsaaarlqssgvmvavaagnnnadarnyspasepsvctv
gasdrydrrssfsnygsvldifgpgtsilstwiggstrsisgtsmatphvaglaaylmtl
gkttaasacryiadtankgdlsnipfgtvnllaynnyqa
SCOP Domain Coordinates for d2prk__:
Click to download the PDB-style file with coordinates for d2prk__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2prk__:
- d2prk__ appears in SCOP 1.57
- d2prk__ appears in the current release, SCOPe 2.08, called d2prka_
View in 3D