Lineage for d1thm__ (1thm -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 23787Fold c.41: Subtilisin-like [52742] (1 superfamily)
  4. 23788Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 23789Family c.41.1.1: Subtilases [52744] (7 proteins)
  6. 23875Protein Thermitase [52760] (1 species)
  7. 23876Species Thermoactinomyces vulgaris [TaxId:2026] [52761] (4 PDB entries)
  8. 23877Domain d1thm__: 1thm - [32544]

Details for d1thm__

PDB Entry: 1thm (more details), 1.37 Å

PDB Description: crystal structure of thermitase at 1.4 angstroms resolution

SCOP Domain Sequences for d1thm__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1thm__ c.41.1.1 (-) Thermitase {Thermoactinomyces vulgaris}
ytpndpyfssrqygpqkiqapqawdiaegsgakiaivdtgvqsnhpdlagkvvggwdfvd
ndstpqngnghgthcagiaaavtnnstgiagtapkasilavrvldnsgsgtwtavangit
yaadqgakvislslggtvgnsglqqavnyawnkgsvvvaaagnagntapnypayysnaia
vastdqndnkssfstygswvdvaapgssiystyptstyaslsgtsmatphvagvagllas
qgrsasniraaientadkisgtgtywakgrvnaykavqy

SCOP Domain Coordinates for d1thm__:

Click to download the PDB-style file with coordinates for d1thm__.
(The format of our PDB-style files is described here.)

Timeline for d1thm__: