SCOPe 2.07: Domain d5l5ps_: 5l5p S:

Lineage for d5l5ps_ (5l5p S:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.0: automated matches [191393] (1 protein)
   not a true family

6. Protein automated matches [190509] (19 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)

8. Domain d5l5ps_: 5l5p S: [325437]
   Other proteins in same PDB: d5l5pa_, d5l5pb_, d5l5pf_, d5l5pg_, d5l5ph_, d5l5pi_, d5l5pj_, d5l5pk_, d5l5pl_, d5l5pm_, d5l5pn_, d5l5po_, d5l5pp_, d5l5pt_, d5l5pu_, d5l5pv_, d5l5pw_, d5l5px_, d5l5py_, d5l5pz_
   automated match to d4g4se_
   complexed with 79l, cl, mes, mg

Details for d5l5ps_

PDB Entry: 5l5p, 2.8 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138) and human beta6 (97- 111; 118-133) in complex with epoxyketone inhibitor 17

PDB Compounds: (S:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5l5ps_:

Sequence; same for both SEQRES and ATOM records:

>d5l5ps_ d.153.1.0 (S:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

Timeline for d5l5ps_:

• d5l5ps_ first appeared in SCOPe 2.06
  
• d5l5ps_ appears in the current release, SCOPe 2.08