Lineage for d1dbia_ (1dbi A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 23787Fold c.41: Subtilisin-like [52742] (1 superfamily)
  4. 23788Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 23789Family c.41.1.1: Subtilases [52744] (7 proteins)
  6. 23881Protein Thermostable serine protease [52758] (1 species)
  7. 23882Species Bacillus sp., AK.1 [TaxId:1409] [52759] (1 PDB entry)
  8. 23883Domain d1dbia_: 1dbi A: [32543]

Details for d1dbia_

PDB Entry: 1dbi (more details), 1.8 Å

PDB Description: crystal structure of a thermostable serine protease

SCOP Domain Sequences for d1dbia_:

Sequence, based on SEQRES records: (download)

>d1dbia_ c.41.1.1 (A:) Thermostable serine protease {Bacillus sp., AK.1}
wtpndtyyqgyqygpqntytdyawdvtkgssgqeiavidtgvdythpdldgkvikgydfv
dndydpmdlnnhgthvagiaaaetnnatgiagmapntrilavraldrngsgtlsdiadai
iyaadsgaevinlslgcdchtttlenavnyawnkgsvvvaaagnngssttfepasyenvi
avgavdqydrlasfsnygtwvdvvapgvdivstitgnryaymsgtsmasphvaglaalla
sqgrnnieirqaieqtadkisgtgtyfkygrinsynavty

Sequence, based on observed residues (ATOM records): (download)

>d1dbia_ c.41.1.1 (A:) Thermostable serine protease {Bacillus sp., AK.1}
wtpndtyyqgyqygpqntytdyawdvtkgssgqeiavidtgvdythpdldgkvikgydfv
dndydpmdlnnhgthvagiaaaetnnatgiagmapntrilavraldrngsgtlsdiadai
iyaadsgaevinlslgcdchtttlenavnyawnkgsvvvaaagnnsyenviavgavdqyd
rlasfsnygtwvdvvapgvdivstitgnryaymsgtsmasphvaglaallasqgrnniei
rqaieqtadkisgtgtyfkygrinsynavty

SCOP Domain Coordinates for d1dbia_:

Click to download the PDB-style file with coordinates for d1dbia_.
(The format of our PDB-style files is described here.)

Timeline for d1dbia_: