Lineage for d1dbia_ (1dbi A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2114952Family c.41.1.1: Subtilases [52744] (14 protein domains)
  6. 2115135Protein Thermostable serine protease [52758] (1 species)
  7. 2115136Species Bacillus sp., AK.1 [TaxId:1409] [52759] (1 PDB entry)
  8. 2115137Domain d1dbia_: 1dbi A: [32543]
    complexed with ca, na

Details for d1dbia_

PDB Entry: 1dbi (more details), 1.8 Å

PDB Description: crystal structure of a thermostable serine protease
PDB Compounds: (A:) ak.1 serine protease

SCOPe Domain Sequences for d1dbia_:

Sequence, based on SEQRES records: (download)

>d1dbia_ c.41.1.1 (A:) Thermostable serine protease {Bacillus sp., AK.1 [TaxId: 1409]}
wtpndtyyqgyqygpqntytdyawdvtkgssgqeiavidtgvdythpdldgkvikgydfv
dndydpmdlnnhgthvagiaaaetnnatgiagmapntrilavraldrngsgtlsdiadai
iyaadsgaevinlslgcdchtttlenavnyawnkgsvvvaaagnngssttfepasyenvi
avgavdqydrlasfsnygtwvdvvapgvdivstitgnryaymsgtsmasphvaglaalla
sqgrnnieirqaieqtadkisgtgtyfkygrinsynavty

Sequence, based on observed residues (ATOM records): (download)

>d1dbia_ c.41.1.1 (A:) Thermostable serine protease {Bacillus sp., AK.1 [TaxId: 1409]}
wtpndtyyqgyqygpqntytdyawdvtkgssgqeiavidtgvdythpdldgkvikgydfv
dndydpmdlnnhgthvagiaaaetnnatgiagmapntrilavraldrngsgtlsdiadai
iyaadsgaevinlslgcdchtttlenavnyawnkgsvvvaaagnnsyenviavgavdqyd
rlasfsnygtwvdvvapgvdivstitgnryaymsgtsmasphvaglaallasqgrnniei
rqaieqtadkisgtgtyfkygrinsynavty

SCOPe Domain Coordinates for d1dbia_:

Click to download the PDB-style file with coordinates for d1dbia_.
(The format of our PDB-style files is described here.)

Timeline for d1dbia_: