Lineage for d5l5ss_ (5l5s S:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2602353Domain d5l5ss_: 5l5s S: [325429]
    Other proteins in same PDB: d5l5sa_, d5l5sb_, d5l5sf_, d5l5sg_, d5l5sh_, d5l5si_, d5l5sj_, d5l5sk_, d5l5sl_, d5l5sm_, d5l5sn_, d5l5so_, d5l5sp_, d5l5st_, d5l5su_, d5l5sv_, d5l5sw_, d5l5sx_, d5l5sy_, d5l5sz_
    automated match to d4g4se_
    complexed with 39v, cl, mg

Details for d5l5ss_

PDB Entry: 5l5s (more details), 2.6 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138; v31m) and human beta6 (97-111; 118-133) in complex with pr-924
PDB Compounds: (S:) Proteasome subunit alpha type-6

SCOPe Domain Sequences for d5l5ss_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5ss_ d.153.1.0 (S:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki
ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy
ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid
gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi

SCOPe Domain Coordinates for d5l5ss_:

Click to download the PDB-style file with coordinates for d5l5ss_.
(The format of our PDB-style files is described here.)

Timeline for d5l5ss_: