Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d5l5ss_: 5l5s S: [325429] Other proteins in same PDB: d5l5sa_, d5l5sb_, d5l5sc2, d5l5sf_, d5l5sg_, d5l5sh_, d5l5si_, d5l5sj_, d5l5sk_, d5l5sl_, d5l5sm_, d5l5sn_, d5l5so_, d5l5sp_, d5l5sq2, d5l5st_, d5l5su_, d5l5sv_, d5l5sw_, d5l5sx_, d5l5sy_, d5l5sz_ automated match to d4g4se_ complexed with 39v, cl, mg |
PDB Entry: 5l5s (more details), 2.6 Å
SCOPe Domain Sequences for d5l5ss_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5ss_ d.153.1.0 (S:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} nnydgdtvtfsptgrlfqveyaleaikqgsvtvglrsnthavlvalkrnadelssyqkki ikcdehmglslaglapdarvlsnylrqqcnysslvfnrklaveraghllcdkaqkntqsy ggrpygvglliigydksgahllefqpsgnvtelygtaigarsqgaktylertldtfikid gnpdelikagveaisqslrdesltvdnlsiaivgkdtpftiydgeavakyi
Timeline for d5l5ss_:
View in 3D Domains from other chains: (mouse over for more information) d5l5sa_, d5l5sb_, d5l5sc1, d5l5sc2, d5l5sd_, d5l5se_, d5l5sf_, d5l5sg_, d5l5sh_, d5l5si_, d5l5sj_, d5l5sk_, d5l5sl_, d5l5sm_, d5l5sn_, d5l5so_, d5l5sp_, d5l5sq1, d5l5sq2, d5l5sr_, d5l5st_, d5l5su_, d5l5sv_, d5l5sw_, d5l5sx_, d5l5sy_, d5l5sz_ |