Lineage for d1mpta_ (1mpt A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1850575Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 1850576Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 1850577Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 1850608Protein M-proteinase [52754] (1 species)
  7. 1850609Species Bacillus sp., strain ksm-k16 [TaxId:1409] [52755] (2 PDB entries)
    Uniprot Q99405 112-380
  8. 1850611Domain d1mpta_: 1mpt A: [32541]
    complexed with ca

Details for d1mpta_

PDB Entry: 1mpt (more details), 2.4 Å

PDB Description: crystal structure of a new alkaline serine protease (m-protease) from bacillus sp. ksm-k16
PDB Compounds: (A:) m-protease

SCOPe Domain Sequences for d1mpta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mpta_ c.41.1.1 (A:) M-proteinase {Bacillus sp., strain ksm-k16 [TaxId: 1409]}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagvaalvkqknpswsnvqi
rnhlkntatglgntnlygsglvnaeaatr

SCOPe Domain Coordinates for d1mpta_:

Click to download the PDB-style file with coordinates for d1mpta_.
(The format of our PDB-style files is described here.)

Timeline for d1mpta_: