SCOPe 2.08: Domain d1mpta_: 1mpt A:

Lineage for d1mpta_ (1mpt A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (15 proteins)

6. Protein M-proteinase [52754] (1 species)

7. Species Bacillus sp., strain ksm-k16 [TaxId:1409] [52755] (2 PDB entries)
   Uniprot Q99405 112-380

8. Domain d1mpta_: 1mpt A: [32541]
   complexed with ca

Details for d1mpta_

PDB Entry: 1mpt, 2.4 Å

PDB Description: crystal structure of a new alkaline serine protease (m-protease) from bacillus sp. ksm-k16

PDB Compounds: (A:) m-protease

SCOPe Domain Sequences for d1mpta_:

Sequence; same for both SEQRES and ATOM records:

>d1mpta_ c.41.1.1 (A:) M-proteinase {Bacillus sp., strain ksm-k16 [TaxId: 1409]}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagvaalvkqknpswsnvqi
rnhlkntatglgntnlygsglvnaeaatr

Timeline for d1mpta_:

• d1mpta_ first appeared (with stable ids) in SCOP 1.55, called d1mpt__
  
• d1mpta_ appears in SCOPe 2.07