SCOP 1.75: Domain d1meea_: 1mee A:

Lineage for d1meea_ (1mee A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (2 families)

5. Family c.41.1.1: Subtilases [52744] (13 proteins)

6. Protein Messentericopeptidase [52752] (1 species)

7. Species Bacillus mesentericus [TaxId:1408] [52753] (1 PDB entry)

8. Domain d1meea_: 1mee A: [32540]
   Other proteins in same PDB: d1meei_
   complexed with ca

Details for d1meea_

PDB Entry: 1mee, 2 Å

PDB Description: the complex between the subtilisin from a mesophilic bacterium and the leech inhibitor eglin-c

PDB Compounds: (A:) mesentericopeptidase

SCOP Domain Sequences for d1meea_:

Sequence; same for both SEQRES and ATOM records:

>d1meea_ c.41.1.1 (A:) Messentericopeptidase {Bacillus mesentericus [TaxId: 1408]}
aqsvpygisqikapalhsqgytgsnvkvavidsgidsshpdlnvrggasfvpsetnpyqd
gsshgthvagtiaalnnsigvlgvapsaslyavkvldstgsgqyswiingiewaisnnmd
vinmslggptgstalktvvdkavssgivvaaaagnegssgststvgypakypstiavgav
nsanqrasfssagseldvmapgvsiqstlpggtygayngtsmatphvagaaalilskhpt
wtnaqvrdrlestatylgssfyygkglinvqaaaq

Timeline for d1meea_:

• d1meea_ first appeared (with stable ids) in SCOP 1.55
  
• d1meea_ appears in SCOP 1.73
  
• d1meea_ appears in SCOPe 2.01
  
• d1meea_ appears in the current release, SCOPe 2.08