SCOPe 2.07: Domain d5l5wf_: 5l5w F:

Lineage for d5l5wf_ (5l5w F:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (14 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (203 PDB entries)

8. Domain d5l5wf_: 5l5w F: [325363]
   Other proteins in same PDB: d5l5wa_, d5l5wc_, d5l5wd_, d5l5we_, d5l5wg_, d5l5wi_, d5l5wj_, d5l5wk_, d5l5wl_, d5l5wo_, d5l5wq_, d5l5wr_, d5l5ws_, d5l5wu_, d5l5ww_, d5l5wx_, d5l5wy_, d5l5wz_
   automated match to d4g4sg_
   complexed with cl, mg

Details for d5l5wf_

PDB Entry: 5l5w, 2.8 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133)

PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d5l5wf_:

Sequence; same for both SEQRES and ATOM records:

>d5l5wf_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

Timeline for d5l5wf_:

• d5l5wf_ first appeared in SCOPe 2.06
  
• d5l5wf_ appears in the current release, SCOPe 2.08