Lineage for d1spbs_ (1spb S:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1366720Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 1366721Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 1366722Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 1366790Protein Subtilisin [52745] (6 species)
  7. 1366791Species Bacillus amyloliquefaciens, Novo/BPN' [TaxId:1390] [52751] (54 PDB entries)
    Uniprot P00782 108-382
  8. 1366839Domain d1spbs_: 1spb S: [32532]
    Other proteins in same PDB: d1spbp_
    CASP1
    complexed with na; mutant

Details for d1spbs_

PDB Entry: 1spb (more details), 2 Å

PDB Description: subtilisin bpn' prosegment (77 residues) complexed with a mutant subtilisin bpn' (266 residues). crystal ph 4.6. crystallization temperature 20 c diffraction temperature-160 c
PDB Compounds: (S:) subtilisin bpn'

SCOPe Domain Sequences for d1spbs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1spbs_ c.41.1.1 (S:) Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' [TaxId: 1390]}
svpygvsqikapalhsqgytgsnvkvavinsgidsshpdlnvaggasfvpsetnpfqdnn
shgthvagtvlavapsaslyavkvlgadgsgqyswiingiewaiannmdvinmslggpsg
saalkaavdkavasgvvvvaaagnegtsgssstvgypgkypsviavgavdssnqrasfss
vgpeldvmapgvsivstlpgnkygaksgtamasphvagaaalilskhpnwtntqvrssle
ntttklgdsfyygkglinvqaaaq

SCOPe Domain Coordinates for d1spbs_:

Click to download the PDB-style file with coordinates for d1spbs_.
(The format of our PDB-style files is described here.)

Timeline for d1spbs_: