SCOPe 2.07: Domain d5l5wi_: 5l5w I:

Lineage for d5l5wi_ (5l5w I:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (7 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (202 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d5l5wi_: 5l5w I: [325278]
   Other proteins in same PDB: d5l5wb_, d5l5wc_, d5l5wd_, d5l5we_, d5l5wf_, d5l5wg_, d5l5wh_, d5l5wk_, d5l5wl_, d5l5wm_, d5l5wn_, d5l5wp_, d5l5wq_, d5l5wr_, d5l5ws_, d5l5wt_, d5l5wu_, d5l5wv_, d5l5wy_, d5l5wz_
   automated match to d4g4sj_
   complexed with cl, mg

Details for d5l5wi_

PDB Entry: 5l5w, 2.8 Å

PDB Description: yeast 20s proteasome with human beta5c (1-138) and human beta6 (97- 111; 118-133)

PDB Compounds: (I:) Proteasome subunit beta type-3

SCOPe Domain Sequences for d5l5wi_:

Sequence; same for both SEQRES and ATOM records:

>d5l5wi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sdpssinggivvamtgkdcvaiacdlrlgsqslgvsnkfekifhyghvflgitglatdvt
tlnemfryktnlyklkeeraiepetftqlvssslyerrfgpyfvgpvvaginsksgkpfi
agfdligcideakdfivsgtasdqlfgmceslyepnlepedlfetisqallnaadrdals
gwgavvyiikkdevvkrylkmrqd

Timeline for d5l5wi_:

• d5l5wi_ first appeared in SCOPe 2.06
  
• d5l5wi_ appears in the current release, SCOPe 2.08