SCOPe 2.05: Domain d1yjaa_: 1yja A:

Lineage for d1yjaa_ (1yja A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (14 proteins)

6. Protein Subtilisin [52745] (7 species)

7. Species Bacillus amyloliquefaciens, Novo/BPN' [TaxId:1390] [52751] (54 PDB entries)
   Uniprot P00782 108-382

8. Domain d1yjaa_: 1yja A: [32527]
   complexed with ca; mutant

Details for d1yjaa_

PDB Entry: 1yja, 1.8 Å

PDB Description: subtilisin bpn' 8397+1 (e.c. 3.4.21.14) (mutant with met 50 replaced by phe, asn 76 replaced by asp, gly 169 replaced by ala, gln 206 replaced by cys, asn 218 replaced by ser and lys 256 replaced by tyr) (m50f, n76d, g169a, q206c, n218s, and k256y) in 20% dimethylformamide

PDB Compounds: (A:) subtilisin 8397+1

SCOPe Domain Sequences for d1yjaa_:

Sequence; same for both SEQRES and ATOM records:

>d1yjaa_ c.41.1.1 (A:) Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' [TaxId: 1390]}
aqsvpygvsqikapalhsqgytgsnvkvavidsgidsshpdlkvaggasfvpsetnpfqd
nnshgthvagtvaaldnsigvlgvapsaslyavkvlgadgsgqyswiingiewaiannmd
vinmslggpsgsaalkaavdkavasgvvvvaaagnegtsgssstvgypakypsviavgav
dssnqrasfssvgpeldvmapgvsicstlpgnkygaysgtsmasphvagaaalilskhpn
wtntqvrsslentttylgdsfyygkglinvqaaaq

Timeline for d1yjaa_:

• d1yjaa_ first appeared (with stable ids) in SCOP 1.55, called d1yja__
  
• d1yjaa_ appears in SCOPe 2.04
  
• d1yjaa_ appears in SCOPe 2.06
  
• d1yjaa_ appears in the current release, SCOPe 2.08