Lineage for d5l5rc_ (5l5r C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2594580Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2594581Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2602131Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2602132Protein automated matches [190509] (19 species)
    not a true protein
  7. 2602194Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries)
  8. 2602514Domain d5l5rc_: 5l5r C: [325238]
    Other proteins in same PDB: d5l5ra_, d5l5rb_, d5l5rf_, d5l5rg_, d5l5rh_, d5l5ri_, d5l5rj_, d5l5rk_, d5l5rl_, d5l5rm_, d5l5rn_, d5l5ro_, d5l5rp_, d5l5rt_, d5l5ru_, d5l5rv_, d5l5rw_, d5l5rx_, d5l5ry_, d5l5rz_
    automated match to d1iruf_
    complexed with cl, mg

Details for d5l5rc_

PDB Entry: 5l5r (more details), 2.9 Å

PDB Description: yeast 20s proteasome with human beta5i (1-138;v31m) and human beta6 (97-111; 118-133)
PDB Compounds: (C:) Proteasome subunit alpha type-4

SCOPe Domain Sequences for d5l5rc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l5rc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps
kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq
sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk
eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe

SCOPe Domain Coordinates for d5l5rc_:

Click to download the PDB-style file with coordinates for d5l5rc_.
(The format of our PDB-style files is described here.)

Timeline for d5l5rc_: