Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.0: automated matches [191393] (1 protein) not a true family |
Protein automated matches [190509] (19 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256123] (110 PDB entries) |
Domain d5l5rc_: 5l5r C: [325238] Other proteins in same PDB: d5l5ra_, d5l5rb_, d5l5rf_, d5l5rg_, d5l5rh_, d5l5ri_, d5l5rj_, d5l5rk_, d5l5rl_, d5l5rm_, d5l5rn_, d5l5ro_, d5l5rp_, d5l5rt_, d5l5ru_, d5l5rv_, d5l5rw_, d5l5rx_, d5l5ry_, d5l5rz_ automated match to d1iruf_ complexed with cl, mg |
PDB Entry: 5l5r (more details), 2.9 Å
SCOPe Domain Sequences for d5l5rc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l5rc_ d.153.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d5l5rc_: