Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Plasmodium vivax [TaxId:126793] [225142] (2 PDB entries) |
Domain d4l0uh_: 4l0u H: [325185] Other proteins in same PDB: d4l0uc2, d4l0ui2 automated match to d3tkpe_ complexed with act |
PDB Entry: 4l0u (more details), 2.5 Å
SCOPe Domain Sequences for d4l0uh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4l0uh_ c.47.1.0 (H:) automated matches {Plasmodium vivax [TaxId: 126793]} ptyvgkeapffkaeavfgdnsfgevnltqfigkkyvllyfypldftfvcpseiialdkal dafhernvellgcsvdskythlawkktplakggignikhtllsditksiskdynvlfdds vslrafvlidmngivqhllvnnlaigrsvdeilriidaiqhhekygd
Timeline for d4l0uh_: