Lineage for d1sbha_ (1sbh A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2114952Family c.41.1.1: Subtilases [52744] (14 protein domains)
  6. 2115024Protein Subtilisin [52745] (7 species)
  7. 2115025Species Bacillus amyloliquefaciens, Novo/BPN' [TaxId:1390] [52751] (54 PDB entries)
    Uniprot P00782 108-382
  8. 2115054Domain d1sbha_: 1sbh A: [32518]
    complexed with ca; mutant

Details for d1sbha_

PDB Entry: 1sbh (more details), 1.8 Å

PDB Description: subtilisin bpn' 8397+1 (e.c. 3.4.21.14) mutant (m50f, n76d, g169a, q206c, n218s, k256y)
PDB Compounds: (A:) subtilisin 8397+1

SCOPe Domain Sequences for d1sbha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbha_ c.41.1.1 (A:) Subtilisin {Bacillus amyloliquefaciens, Novo/BPN' [TaxId: 1390]}
aqsvpygvsqikapalhsqgytgsnvkvavidsgidsshpdlkvaggasfvpsetnpfqd
nnshgthvagtvaaldnsigvlgvapsaslyavkvlgadgsgqyswiingiewaiannmd
vinmslggpsgsaalkaavdkavasgvvvvaaagnegtsgssstvgypakypsviavgav
dssnqrasfssvgpeldvmapgvsicstlpgnkygaysgtsmasphvagaaalilskhpn
wtntqvrsslentttylgdsfyygkglinvqaaaq

SCOPe Domain Coordinates for d1sbha_:

Click to download the PDB-style file with coordinates for d1sbha_.
(The format of our PDB-style files is described here.)

Timeline for d1sbha_: