| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.3: Cytochromes [47175] (3 families) ![]() Heme-containing proteins |
| Family a.24.3.1: Cytochrome b562 [47176] (2 proteins) automatically mapped to Pfam PF07361 |
| Protein Cytochrome b562 [47177] (1 species) |
| Species Escherichia coli [TaxId:562] [47178] (75 PDB entries) |
| Domain d5l31a_: 5l31 A: [325123] automated match to d4jeaa_ complexed with hec, na |
PDB Entry: 5l31 (more details), 2.4 Å
SCOPe Domain Sequences for d5l31a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l31a_ a.24.3.1 (A:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr
Timeline for d5l31a_: