Lineage for d5l0qe2 (5l0q E:108-212)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751382Domain d5l0qe2: 5l0q E:108-212 [325116]
    Other proteins in same PDB: d5l0qb1, d5l0qc_, d5l0qe1, d5l0qf_
    automated match to d1yecl2
    complexed with mg, nag, so4

Details for d5l0qe2

PDB Entry: 5l0q (more details), 2.76 Å

PDB Description: crystal structure of the complex between adam10 d+c domain and a conformation specific mab 8c7.
PDB Compounds: (E:) mAb 8C7 light chain

SCOPe Domain Sequences for d5l0qe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l0qe2 b.1.1.2 (E:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d5l0qe2:

Click to download the PDB-style file with coordinates for d5l0qe2.
(The format of our PDB-style files is described here.)

Timeline for d5l0qe2: