SCOPe 2.06: Domain d5l31c_: 5l31 C:

Lineage for d5l31c_ (5l31 C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.3: Cytochromes [47175] (3 families)
   Heme-containing proteins

5. Family a.24.3.1: Cytochrome b562 [47176] (2 proteins)
   automatically mapped to Pfam PF07361

6. Protein automated matches [190502] (2 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [187450] (39 PDB entries)

8. Domain d5l31c_: 5l31 C: [325102]
   automated match to d4jeaa_
   complexed with hem, na

Details for d5l31c_

PDB Entry: 5l31, 2.4 Å

PDB Description: crystal structure of an engineered metal-free ridc1 variant containing five disulfide bonds.

PDB Compounds: (C:) Soluble cytochrome b562

SCOPe Domain Sequences for d5l31c_:

Sequence, based on SEQRES records:

>d5l31c_ a.24.3.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppkledkspdspemhd
frhgfwiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr

Sequence, based on observed residues (ATOM records):

>d5l31c_ a.24.3.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvkdaltkmaaaacdawsatppspdspemhdfrhgf
wiligqihdalhlancgkvkeaqaaaeqlkctcnachqkyr

Timeline for d5l31c_:

• d5l31c_ is new in SCOPe 2.06-stable
  
• d5l31c_ appears in SCOPe 2.07
  
• d5l31c_ appears in the current release, SCOPe 2.08