SCOPe 2.08: Domain d5l0qb2: 5l0q B:108-212

Lineage for d5l0qb2 (5l0q B:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5l0qb2: 5l0q B:108-212 [325087]
   Other proteins in same PDB: d5l0qb1, d5l0qc_, d5l0qe1, d5l0qf_
   automated match to d1yecl2
   complexed with mg, nag, so4

Details for d5l0qb2

PDB Entry: 5l0q, 2.76 Å

PDB Description: crystal structure of the complex between adam10 d+c domain and a conformation specific mab 8c7.

PDB Compounds: (B:) mAb 8C7 light chain

SCOPe Domain Sequences for d5l0qb2:

Sequence; same for both SEQRES and ATOM records:

>d5l0qb2 b.1.1.2 (B:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d5l0qb2:

• d5l0qb2 first appeared in SCOPe 2.06
  
• d5l0qb2 appears in SCOPe 2.07