Lineage for d5ec7c_ (5ec7 C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2053585Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2053714Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2054180Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2054181Protein automated matches [190457] (10 species)
    not a true protein
  7. 2054213Species Chicken (Gallus gallus) [TaxId:9031] [225620] (14 PDB entries)
  8. 2054231Domain d5ec7c_: 5ec7 C: [325080]
    automated match to d5i11a_
    complexed with peg

Details for d5ec7c_

PDB Entry: 5ec7 (more details), 1.65 Å

PDB Description: crystal structure of a chimeric c-src-sh3 domain with the sequence of the rt-loop from the abl-sh3 domain at ph 5.0
PDB Compounds: (C:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d5ec7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ec7c_ b.34.2.0 (C:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyvasgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvap

SCOPe Domain Coordinates for d5ec7c_:

Click to download the PDB-style file with coordinates for d5ec7c_.
(The format of our PDB-style files is described here.)

Timeline for d5ec7c_: