Lineage for d4l0uc1 (4l0u C:2-172)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2880136Species Plasmodium vivax [TaxId:126793] [225142] (2 PDB entries)
  8. 2880144Domain d4l0uc1: 4l0u C:2-172 [325073]
    Other proteins in same PDB: d4l0uc2, d4l0ui2
    automated match to d3tkpe_
    complexed with act

Details for d4l0uc1

PDB Entry: 4l0u (more details), 2.5 Å

PDB Description: crystal structure of plasmodium vivax prx1a
PDB Compounds: (C:) 2-Cys peroxiredoxin, putative

SCOPe Domain Sequences for d4l0uc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4l0uc1 c.47.1.0 (C:2-172) automated matches {Plasmodium vivax [TaxId: 126793]}
ptyvgkeapffkaeavfgdnsfgevnltqfigkkyvllyfypldftfvcpseiialdkal
dafhernvellgcsvdskythlawkktplakggignikhtllsditksiskdynvlfdds
vslrafvlidmngivqhllvnnlaigrsvdeilriidaiqhhekygdvcpa

SCOPe Domain Coordinates for d4l0uc1:

Click to download the PDB-style file with coordinates for d4l0uc1.
(The format of our PDB-style files is described here.)

Timeline for d4l0uc1: