Lineage for d5eigg_ (5eig G:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (140 species)
    not a true protein
  7. 2472575Species Human (Homo sapiens) [TaxId:9606] [188446] (25 PDB entries)
  8. 2472649Domain d5eigg_: 5eig G: [325064]
    automated match to d3cogc_
    complexed with cys, so4

Details for d5eigg_

PDB Entry: 5eig (more details), 2.7 Å

PDB Description: engineered human cystathionine gamma lyase (e59t, e339v) to deplet cysteine
PDB Compounds: (G:) Cystathionine gamma-lyase

SCOPe Domain Sequences for d5eigg_:

Sequence, based on SEQRES records: (download)

>d5eigg_ c.67.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqhsgftysrsgnptrn
clekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnryfrqvasefg
lkisfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdnt
fmspyfqrplalgadismysatxymnghsdvvmglvsvnceslhnrlrflqnslgavpsp
idcylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctg
ctgmvtfyikgtlqhaeiflknlklftlavslggfeslaelpaimthasvlkndrdvlgi
sdtlirlsvgledeedlledldqalkaahp

Sequence, based on observed residues (ATOM records): (download)

>d5eigg_ c.67.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gflphfqhfatqaihvgqdpeqwtsravvppislsttfkqgapgqgftysrsgnptrncl
ekavaaldgakyclafasglaatvtithllkagdqiicmddvyggtnryfrqvasefglk
isfvdcskiklleaaitpetklvwietptnptqkvidiegcahivhkhgdiilvvdntfm
spyfqrplalgadismysatxymnghsdvvmglvsvnceslhnrlrflqnslgavpspid
cylcnrglktlhvrmekhfkngmavaqflesnpwvekviypglpshpqhelvkrqctgct
gmvtfyikgtlqhaeiflknlklftlavslggfeslaelpaimthasvlkndrdvlgisd
tlirlsvgledeedlledldqalkaahp

SCOPe Domain Coordinates for d5eigg_:

Click to download the PDB-style file with coordinates for d5eigg_.
(The format of our PDB-style files is described here.)

Timeline for d5eigg_: