Lineage for d5ecaa1 (5eca A:85-141)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2783360Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2783361Protein automated matches [190457] (10 species)
    not a true protein
  7. 2783393Species Chicken (Gallus gallus) [TaxId:9031] [225620] (18 PDB entries)
  8. 2783399Domain d5ecaa1: 5eca A:85-141 [325047]
    Other proteins in same PDB: d5ecaa2
    automated match to d3read_

Details for d5ecaa1

PDB Entry: 5eca (more details), 1.16 Å

PDB Description: crystal structure of a chimeric c-src-sh3 domain with the sequence of the rt-loop from the abl-sh3 domain at ph 6.5
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d5ecaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ecaa1 b.34.2.0 (A:85-141) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyvasgetdlsfkkgerlqivnntegdwwlahslttgrtgyipsnyvapsd

SCOPe Domain Coordinates for d5ecaa1:

Click to download the PDB-style file with coordinates for d5ecaa1.
(The format of our PDB-style files is described here.)

Timeline for d5ecaa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5ecaa2