Lineage for d1st3a_ (1st3 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1850575Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 1850576Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 1850577Family c.41.1.1: Subtilases [52744] (14 proteins)
  6. 1850648Protein Subtilisin [52745] (7 species)
  7. 1850706Species Bacillus lentus [TaxId:1467] [52750] (9 PDB entries)
  8. 1850708Domain d1st3a_: 1st3 A: [32504]
    complexed with ca

Details for d1st3a_

PDB Entry: 1st3 (more details), 1.4 Å

PDB Description: the crystal structure of the bacillus lentus alkaline protease, subtilisin bl, at 1.4 angstroms resolution
PDB Compounds: (A:) subtilisin bl

SCOPe Domain Sequences for d1st3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1st3a_ c.41.1.1 (A:) Subtilisin {Bacillus lentus [TaxId: 1467]}
gqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgadgrgaissiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgassisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr

SCOPe Domain Coordinates for d1st3a_:

Click to download the PDB-style file with coordinates for d1st3a_.
(The format of our PDB-style files is described here.)

Timeline for d1st3a_: