Lineage for d5k51a_ (5k51 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143900Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2143901Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2143902Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2143960Protein Hypoxanthine PRTase [53286] (4 species)
  7. 2143971Species Trypanosoma brucei [TaxId:5702] [324926] (5 PDB entries)
  8. 2143980Domain d5k51a_: 5k51 A: [325032]
    automated match to d1p17b_
    complexed with 6qd

Details for d5k51a_

PDB Entry: 5k51 (more details), 2.96 Å

PDB Description: trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with a 9-[5-(phosphonoheptyl]hypoxanthine
PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d5k51a_:

Sequence, based on SEQRES records: (download)

>d5k51a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
ydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmvri
lgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvledildtaltlrevv
dslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvi
lkpsvyetwgk

Sequence, based on observed residues (ATOM records): (download)

>d5k51a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
ydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmvri
lgdfgvptrveflirgkhvlvledildtaltlrevvdslkksepasiktlvaidkpggrk
ipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgk

SCOPe Domain Coordinates for d5k51a_:

Click to download the PDB-style file with coordinates for d5k51a_.
(The format of our PDB-style files is described here.)

Timeline for d5k51a_: