Lineage for d1svna_ (1svn A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 832496Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 832497Superfamily c.41.1: Subtilisin-like [52743] (2 families) (S)
  5. 832498Family c.41.1.1: Subtilases [52744] (13 proteins)
  6. 832575Protein Subtilisin [52745] (6 species)
  7. 832641Species Bacillus lentus, savinase (TM) [TaxId:1467] [52749] (2 PDB entries)
    Uniprot P29600
  8. 832642Domain d1svna_: 1svn A: [32502]
    complexed with ca

Details for d1svna_

PDB Entry: 1svn (more details), 1.4 Å

PDB Description: savinase
PDB Compounds: (A:) savinase (tm)

SCOP Domain Sequences for d1svna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1svna_ c.41.1.1 (A:) Subtilisin {Bacillus lentus, savinase (TM) [TaxId: 1467]}
aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
rnhlkntatslgstnlygsglvnaeaatr

SCOP Domain Coordinates for d1svna_:

Click to download the PDB-style file with coordinates for d1svna_.
(The format of our PDB-style files is described here.)

Timeline for d1svna_: