Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.41: Subtilisin-like [52742] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3 |
Superfamily c.41.1: Subtilisin-like [52743] (2 families) |
Family c.41.1.1: Subtilases [52744] (13 proteins) |
Protein Subtilisin [52745] (6 species) |
Species Bacillus lentus, savinase (TM) [TaxId:1467] [52749] (2 PDB entries) Uniprot P29600 |
Domain d1svna_: 1svn A: [32502] complexed with ca |
PDB Entry: 1svn (more details), 1.4 Å
SCOP Domain Sequences for d1svna_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1svna_ c.41.1.1 (A:) Subtilisin {Bacillus lentus, savinase (TM) [TaxId: 1467]} aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi rnhlkntatslgstnlygsglvnaeaatr
Timeline for d1svna_: