SCOPe 2.08: Domain d5glua2: 5glu A:145-278

Lineage for d5glua2 (5glu A:145-278)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Toxascaris leonina [TaxId:59264] [256287] (7 PDB entries)

8. Domain d5glua2: 5glu A:145-278 [325007]
   Other proteins in same PDB: d5glua3, d5glub3
   automated match to d4hl0a2

Details for d5glua2

PDB Entry: 5glu, 2.1 Å

PDB Description: tl-gal with sialac

PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d5glua2:

Sequence; same for both SEQRES and ATOM records:

>d5glua2 b.29.1.0 (A:145-278) automated matches {Toxascaris leonina [TaxId: 59264]}
yypvpyesglagdglapgksllifatpekkgkrfhinllkkngdialhfnprfdekaivr
nslisgewgneeregknplekgigcdlefrneeyafqiyvdgerfatyahrldphdingl
qiggdvevtgiqmv

Timeline for d5glua2:

• d5glua2 first appeared in SCOPe 2.06
  
• d5glua2 appears in SCOPe 2.07