SCOPe 2.08: Domain d4l0wa1: 4l0w A:8-176

Lineage for d4l0wa1 (4l0w A:8-176)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Plasmodium yoelii [TaxId:73239] [324996] (1 PDB entry)

8. Domain d4l0wa1: 4l0w A:8-176 [324997]
   Other proteins in same PDB: d4l0wa2
   automated match to d2i81b_
   complexed with act, so4

Details for d4l0wa1

PDB Entry: 4l0w, 2.29 Å

PDB Description: plasmodium yoelii prx1a modified at the n-terminus forms an artifactual octamer

PDB Compounds: (A:) Thioredoxin peroxidase 1

SCOPe Domain Sequences for d4l0wa1:

Sequence; same for both SEQRES and ATOM records:

>d4l0wa1 c.47.1.0 (A:8-176) automated matches {Plasmodium yoelii [TaxId: 73239]}
qapsfkaeavfgdntfgevslsdfigkkyvllyfypldftfvcpseiialdkaldsfker
nvellgcsvdskfthlawkktplsqggignikhtlisdisksiarsydvlfnesvalraf
vlidkqgvvqhllvnnlalgrsvdeilrlidalqhhekygdvcpanwqk

Timeline for d4l0wa1:

• d4l0wa1 first appeared in SCOPe 2.06
  
• d4l0wa1 appears in SCOPe 2.07