Lineage for d5ehma_ (5ehm A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2522911Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [272003] (3 PDB entries)
  8. 2522912Domain d5ehma_: 5ehm A: [324986]
    automated match to d4mf3a_
    complexed with oem

Details for d5ehma_

PDB Entry: 5ehm (more details), 1.28 Å

PDB Description: crystal structure of the drosophila cg3822 kair1d ligand binding domain complex with nmda
PDB Compounds: (A:) RE06730p,CG3822

SCOPe Domain Sequences for d5ehma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ehma_ c.94.1.0 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
anlknktlvvttilsnpycmrkesaiplsgndqfegyavdliheiskslgfnykiqlvpd
gsygslnkltgewngmirelleqradlaiadltitfereqavdfttpfmnlgvsilyrkg
tpiesaedlakqtrikygalkggstaaffrdskistyqrmwsfmesarpsvftasngegv
ervakgkgsyaflmestsieyvternceltqvggmldtksygiatppnspyrtainsvil
klqeegklhilktkwwkekrg

SCOPe Domain Coordinates for d5ehma_:

Click to download the PDB-style file with coordinates for d5ehma_.
(The format of our PDB-style files is described here.)

Timeline for d5ehma_: