SCOPe 2.06: Domain d5k51b_: 5k51 B:

Lineage for d5k51b_ (5k51 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine PRTase [53286] (4 species)

7. Species Trypanosoma brucei [TaxId:5702] [324926] (5 PDB entries)

8. Domain d5k51b_: 5k51 B: [324985]
   automated match to d1p17b_
   complexed with 6qd

Details for d5k51b_

PDB Entry: 5k51, 2.96 Å

PDB Description: trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with a 9-[5-(phosphonoheptyl]hypoxanthine

PDB Compounds: (B:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d5k51b_:

Sequence, based on SEQRES records:

>d5k51b_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
ydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmvri
lgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvledildtaltlrevv
dslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvi
lkpsvyetw

Sequence, based on observed residues (ATOM records):

>d5k51b_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
ydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmvri
lgdfgvptrveflcdirgkhvlvledildtaltlrevvdslkksepasiktlvaidkpgg
rkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetw

Timeline for d5k51b_:

• d5k51b_ is new in SCOPe 2.06-stable
  
• d5k51b_ appears in SCOPe 2.07
  
• d5k51b_ appears in the current release, SCOPe 2.08