SCOPe 2.06: Domain d5h16b_: 5h16 B:

Lineage for d5h16b_ (5h16 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.0: automated matches [191377] (1 protein)
   not a true family

6. Protein automated matches [190459] (50 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:470] [324884] (3 PDB entries)

8. Domain d5h16b_: 5h16 B: [324981]
   automated match to d3f3ma_
   complexed with cit

Details for d5h16b_

PDB Entry: 5h16, 2.3 Å

PDB Description: crystal structure of the complex of phosphopantetheine adenylyltransferase from acinetobacter baumannii with citrate at 2.3 a resolution.

PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d5h16b_:

Sequence; same for both SEQRES and ATOM records:

>d5h16b_ c.26.1.0 (B:) automated matches {Acinetobacter baumannii [TaxId: 470]}
ktrviypgtfdpitnghvdlvtrasrmfdevvvaiaighhknplfsleervalaqsslgh
lsnvefvgfdgllvnffkeqkatavlrglravsdfeyefqlanmnrqldphfeavfltps
eqysfisstlireiarlkgdvtkfvpqavveaferkhqqgw

Timeline for d5h16b_:

• d5h16b_ is new in SCOPe 2.06-stable
  
• d5h16b_ appears in SCOPe 2.07
  
• d5h16b_ appears in the current release, SCOPe 2.08