SCOPe 2.07: Domain d5jv5a1: 5jv5 A:1-199

Lineage for d5jv5a1 (5jv5 A:1-199)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine PRTase [53286] (4 species)

7. Species Trypanosoma brucei [TaxId:5702] [324926] (10 PDB entries)

8. Domain d5jv5a1: 5jv5 A:1-199 [324977]
   Other proteins in same PDB: d5jv5a2, d5jv5b2
   automated match to d1p17b_
   complexed with 5gp, mg, so4

Details for d5jv5a1

PDB Entry: 5jv5, 2.73 Å

PDB Description: trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with guanosine 5' monophosphate

PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d5jv5a1:

Sequence, based on SEQRES records:

>d5jv5a1 c.61.1.1 (A:1-199) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
mepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvft
admvrilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvledildtal
tlrevvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldydqsyre
vrdvvilkpsvyetwgkel

Sequence, based on observed residues (ATOM records):

>d5jv5a1 c.61.1.1 (A:1-199) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
mepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvft
admvrilgdfgvptrveflrlcdirgkhvlvledildtaltlrevvdslkksepasiktl
vaidkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgkel

Timeline for d5jv5a1:

• d5jv5a1 first appeared in SCOPe 2.06
  
• d5jv5a1 appears in the current release, SCOPe 2.08