Lineage for d5glvb1 (5glv B:2-144)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (60 species)
    not a true protein
  7. 2375657Species Toxascaris leonina [TaxId:59264] [256287] (7 PDB entries)
  8. 2375664Domain d5glvb1: 5glv B:2-144 [324974]
    Other proteins in same PDB: d5glva3, d5glvb3
    automated match to d4hl0a1

Details for d5glvb1

PDB Entry: 5glv (more details), 1.8 Å

PDB Description: tl-gal
PDB Compounds: (B:) galectin

SCOPe Domain Sequences for d5glvb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5glvb1 b.29.1.0 (B:2-144) automated matches {Toxascaris leonina [TaxId: 59264]}
atetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisvr
fdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrvp
lssvthfsvdgdilityihwggk

SCOPe Domain Coordinates for d5glvb1:

Click to download the PDB-style file with coordinates for d5glvb1.
(The format of our PDB-style files is described here.)

Timeline for d5glvb1: