Lineage for d5k8ta2 (5k8t A:482-620)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. Protein automated matches [190123] (156 species)
    not a true protein
  7. Species Zika virus [TaxId:64320] [317810] (28 PDB entries)
  8. Domain d5k8ta2: 5k8t A:482-620 [324970]
    Other proteins in same PDB: d5k8ta1
    automated match to d2bmfa1
    complexed with cl, gsp, mg

Details for d5k8ta2

PDB Entry: 5k8t (more details), 1.85 Å

PDB Description: crystal structure of zikv ns3 helicase in complex with gtp-gammar s and an magnesium ion
PDB Compounds: (A:) ZIKV NS3 helicase

SCOPe Domain Sequences for d5k8ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k8ta2 c.37.1.0 (A:482-620) automated matches {Zika virus [TaxId: 64320]}
edhahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdl
pvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtrhgekrvlkprwmdarvcs
dhaalksfkefaagkraaa

SCOPe Domain Coordinates for d5k8ta2 are not available.

Timeline for d5k8ta2:

Domains from same chain:
(mouse over for more information)
d5k8ta1