SCOPe 2.08: Domain d5k8ta2: 5k8t A:482-620

Lineage for d5k8ta2 (5k8t A:482-620)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [317810] (28 PDB entries)

8. Domain d5k8ta2: 5k8t A:482-620 [324970]
   Other proteins in same PDB: d5k8ta1
   automated match to d2bmfa1
   complexed with cl, gsp, mg

Details for d5k8ta2

PDB Entry: 5k8t, 1.85 Å

PDB Description: crystal structure of zikv ns3 helicase in complex with gtp-gammar s and an magnesium ion

PDB Compounds: (A:) ZIKV NS3 helicase

SCOPe Domain Sequences for d5k8ta2:

Sequence; same for both SEQRES and ATOM records:

>d5k8ta2 c.37.1.0 (A:482-620) automated matches {Zika virus [TaxId: 64320]}
edhahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdl
pvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtrhgekrvlkprwmdarvcs
dhaalksfkefaagkraaa

Timeline for d5k8ta2:

• d5k8ta2 first appeared in SCOPe 2.06
  
• d5k8ta2 appears in SCOPe 2.07