Lineage for d5jsqb_ (5jsq B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891394Protein Hypoxanthine PRTase [53286] (4 species)
  7. 2891405Species Trypanosoma brucei [TaxId:5702] [324926] (10 PDB entries)
  8. 2891407Domain d5jsqb_: 5jsq B: [324962]
    automated match to d1p17b_
    complexed with 6ms, gol, mg, peg, so4

Details for d5jsqb_

PDB Entry: 5jsq (more details), 1.5 Å

PDB Description: trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with a 9-[7-(phosphonoheptyl]guanine
PDB Compounds: (B:) hypoxanthine-guanine phosphoribosyltranferase

SCOPe Domain Sequences for d5jsqb_:

Sequence, based on SEQRES records: (download)

>d5jsqb_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
rilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvledildtaltlre
vvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdv
vilkpsvyetwg

Sequence, based on observed residues (ATOM records): (download)

>d5jsqb_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
rilgdfgvptrveflrglcdirgkhvlvledildtaltlrevvdslkksepasiktlvai
dkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwg

SCOPe Domain Coordinates for d5jsqb_:

Click to download the PDB-style file with coordinates for d5jsqb_.
(The format of our PDB-style files is described here.)

Timeline for d5jsqb_: