SCOPe 2.08: Domain d5jsqb_: 5jsq B:

Lineage for d5jsqb_ (5jsq B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein Hypoxanthine PRTase [53286] (4 species)

7. Species Trypanosoma brucei [TaxId:5702] [324926] (10 PDB entries)

8. Domain d5jsqb_: 5jsq B: [324962]
   automated match to d1p17b_
   complexed with 6ms, gol, mg, peg, so4

Details for d5jsqb_

PDB Entry: 5jsq, 1.5 Å

PDB Description: trypanosome brucei hypoxanthine-guanine phosphoribosyltranferase in complex with a 9-[7-(phosphonoheptyl]guanine

PDB Compounds: (B:) hypoxanthine-guanine phosphoribosyltranferase

SCOPe Domain Sequences for d5jsqb_:

Sequence, based on SEQRES records:

>d5jsqb_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
rilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvledildtaltlre
vvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdv
vilkpsvyetwg

Sequence, based on observed residues (ATOM records):

>d5jsqb_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
rilgdfgvptrveflrglcdirgkhvlvledildtaltlrevvdslkksepasiktlvai
dkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwg

Timeline for d5jsqb_:

• d5jsqb_ first appeared in SCOPe 2.06
  
• d5jsqb_ appears in SCOPe 2.07