Lineage for d5jh2a_ (5jh2 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2415941Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2416428Family c.1.7.0: automated matches [191491] (1 protein)
    not a true family
  6. 2416429Protein automated matches [190793] (26 species)
    not a true protein
  7. 2416513Species Maize (Zea mays) [TaxId:4577] [324924] (4 PDB entries)
  8. 2416517Domain d5jh2a_: 5jh2 A: [324958]
    automated match to d3h7ra_
    complexed with a2p, cl, edo

Details for d5jh2a_

PDB Entry: 5jh2 (more details), 1.72 Å

PDB Description: crystal structure of the holo form of akr4c7 from maize
PDB Compounds: (A:) Aldose reductase, AKR4C7

SCOPe Domain Sequences for d5jh2a_:

Sequence, based on SEQRES records: (download)

>d5jh2a_ c.1.7.0 (A:) automated matches {Maize (Zea mays) [TaxId: 4577]}
arhfvlntgakipsvglgswqsdpgvvgnavyaavkagyrhidcarvygnekeiglalkk
lfeegvvkredmfitsklwndhhapedvpealndslndlqleyldlylihwpfrvkkgtn
tspenfvtpdfpatwgameklydagkaraigvsnfsskklgdllavarvppavdqvechp
gwqqtklhsfcqstgvhltaysplgspgttwmngnvlkepiiisiaeklgktsaqvalrw
niqmghsvlpkstneerikqnldvydwsipddllakfseikqa

Sequence, based on observed residues (ATOM records): (download)

>d5jh2a_ c.1.7.0 (A:) automated matches {Maize (Zea mays) [TaxId: 4577]}
arhfvlntgakipsvglgswqsdpgvvgnavyaavkagyrhidcarvygnekeiglalkk
lfeegvvkredmfitsklwndhhapedvpealndslndlqleyldlylihwpffpatwga
meklydagkaraigvsnfsskklgdllavarvppavdqvechpgwqqtklhsfcqstgvh
ltaysplgnvlkepiiisiaeklgktsaqvalrwniqmghsvlpkstneerikqnldvyd
wsipddllakfseikqa

SCOPe Domain Coordinates for d5jh2a_:

Click to download the PDB-style file with coordinates for d5jh2a_.
(The format of our PDB-style files is described here.)

Timeline for d5jh2a_: