Lineage for d5jo9a_ (5jo9 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107105Species Bradyrhizobium japonicum [TaxId:375] [324952] (1 PDB entry)
  8. 2107106Domain d5jo9a_: 5jo9 A: [324953]
    automated match to d1yb1a_
    complexed with po4, sor

Details for d5jo9a_

PDB Entry: 5jo9 (more details), 2.89 Å

PDB Description: structural characterization of the thermostable bradyrhizobium japonicum d-sorbitol dehydrogenase
PDB Compounds: (A:) Ribitol 2-dehydrogenase

SCOPe Domain Sequences for d5jo9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jo9a_ c.2.1.0 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 375]}
elegkvaavtgaasgiglasaeamlaagarvvmvdrdeaalkalcnkhgdtviplvvdll
dpedcatllprvlekacqldilhanagtyvggdlvdadtmaidrmlnlnvnvvmknvhdv
lphmierrtgdiivtsslaahfptpwepvyasskwaincfvqtvrrqvfkhgirvgsisp
gpvvsalladwppeklkeardsgslleasdvaevvmfmltrprgmtirdvlmlptnfdl

SCOPe Domain Coordinates for d5jo9a_:

Click to download the PDB-style file with coordinates for d5jo9a_.
(The format of our PDB-style files is described here.)

Timeline for d5jo9a_: