Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (239 species) not a true protein |
Species Bradyrhizobium japonicum [TaxId:375] [324952] (1 PDB entry) |
Domain d5jo9a_: 5jo9 A: [324953] automated match to d1yb1a_ complexed with po4, sor |
PDB Entry: 5jo9 (more details), 2.89 Å
SCOPe Domain Sequences for d5jo9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jo9a_ c.2.1.0 (A:) automated matches {Bradyrhizobium japonicum [TaxId: 375]} elegkvaavtgaasgiglasaeamlaagarvvmvdrdeaalkalcnkhgdtviplvvdll dpedcatllprvlekacqldilhanagtyvggdlvdadtmaidrmlnlnvnvvmknvhdv lphmierrtgdiivtsslaahfptpwepvyasskwaincfvqtvrrqvfkhgirvgsisp gpvvsalladwppeklkeardsgslleasdvaevvmfmltrprgmtirdvlmlptnfdl
Timeline for d5jo9a_: