Lineage for d5gltb1 (5glt B:2-144)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. Protein automated matches [190437] (67 species)
    not a true protein
  7. Species Toxascaris leonina [TaxId:59264] [256287] (7 PDB entries)
  8. Domain d5gltb1: 5glt B:2-144 [324949]
    Other proteins in same PDB: d5glta3, d5gltb3
    automated match to d4hl0a1

Details for d5gltb1

PDB Entry: 5glt (more details), 2 Å

PDB Description: tl-gal with lnt
PDB Compounds: (B:) galectin

SCOPe Domain Sequences for d5gltb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gltb1 b.29.1.0 (B:2-144) automated matches {Toxascaris leonina [TaxId: 59264]}
atetnypvpyrskltepfepgqtliikgktaedsvrftinlhntsadfsgndvplhisvr
fdegkivfntfskgewgkeerksnpykkgddidirirahdskfsisvdqkevkeyehrvp
lssvthfsvdgdilityihwggk

SCOPe Domain Coordinates for d5gltb1 are not available.

Timeline for d5gltb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5gltb2, d5gltb3
View in 3D
Domains from other chains:
(mouse over for more information)
d5glta1, d5glta2, d5glta3